2 controlling one or two servos with a potentiometer or sensor
báo cáo hóa học:" Establishment of an animal model of a pasteurized bone graft, with a preliminary analysis of muscle coverage or FGF-2 administration to the graft" potx
Ngày tải lên :
20/06/2014, 04:20
... and graft bone of the harvested samples radiographically Bone formation on the host bone was assessed When the new bone formation was larger than the nearby cortex, the bone formation was classified ... formation (1) and bridging or lamellar bone formation (2) An assessment of these results was made and agreed upon by AS, TY and NT Tartrate-resistant acid phosphatase (TRAP) staining After radiographical ... radiographs or histologically Bone absorption and formation on the graft were assessed with plain radiographs When the bone was absorbed within the cortex, the result was classified as mild absorption,...
- 10
- 478
- 0
Hunging out with one or two close friends vs many friends
Ngày tải lên :
29/08/2016, 22:26
... ( Word Reader - Unregistered ) www.word-reader.com word with my friend and I`d have the best conversation ever ...
- 2
- 497
- 0
Hunging out with one or two close friends vs many friends 4
Ngày tải lên :
29/08/2016, 22:27
... two close friends will give me warmer and more intimated feeling, but sometimes it also let me feel a little bit serious and pressing Comparing with both of them, I would like to be with ... serious and pressing Comparing with both of them, I would like to be with some of my friends and enjoy with them ...
- 2
- 533
- 0
Hunging out with one or two close friends vs many friends5
Ngày tải lên :
29/08/2016, 22:27
... that if one wants to relieve his stress or burden or any kind of difficulty he is facing then he can open out his secrets to his trustworthy friends who are close to him and in this way he can ... friends who are close to him and in this way he can also know who are his true friends A beautiful quote can be presented "A friend in need is a friend indeed" ...
- 2
- 557
- 0
Báo cáo y học: " Evaluation of Lumbar Facet Joint Nerve Blocks in Managing Chronic Low Back Pain: A Randomized, Double-Blind, Controlled Trial with a 2-Year Follow-U"
Ngày tải lên :
26/10/2012, 09:07
... bupivacaine with or without Sarapin Group II = bupivacaine and steroids with or without Sarapin WC = Workers compensation MVA = Motor vehicle injury Analysis of Data Numbers Analyzed Data were analyzed ... C-fibres Acta Anaesthesiol Scand 1990; 34: 335-8 69 Pasqualucci A, Varrassi G, Braschi A, et al Epidural local anesthetic plus corticosteroid for the treatment of cervical brachial radicular pain: ... between groups One- way analysis of variance was used for comparison of means among groups Initially, categories with or without Sarapin in each group were analyzed by comparing them to each other...
- 12
- 669
- 0
Bài soạn ONE – CLASS SUPPOR VECTOR MACHINES (SVMS) WITH A CONFORMAL KERNEL
Ngày tải lên :
26/11/2013, 17:11
... phương pháp tiếp cận SVM đến class imbalance SVM Classifier Binary with symm.margin Binary with asymm.margin One- class with RBF kernel One- class with conformal kernel Accuracy 89.6% 74.4% 74.6% 75.6% ... Asymmetrical margin approach to surveillance of nosocomial infections using support vector classification In Intelligent Data Analysis in Medicine and Pharmacology, 2003 C.Cortes and V.Vapnik Support ... N.Japkowicz The class imbalance problem : A systematic study Intelligent Data Analysis Journal, 6(5), 2002 15 M.Kubat and S.Matwin Addressing the curse of imbalanced data sets : One- sides sampling...
- 16
- 512
- 4
Tài liệu IELTS Speaking Part Two Tasks with unusual or difficult topics ppt
Ngày tải lên :
19/01/2014, 07:20
... read the same thing Describe a famous painting or photo you have seen or know about You should say: - What it shows - What is unusual about it - Why it is famous And say if you would like to hang ... that programme And say how that programme is different from other TV programmes that you like Describe a TV programme that you watch or know about You should say: - When it is on and which channel ... should say: What film and what type of film it is When you saw it What your favourite part of the film is And explain why it made an impression on you Talk about something you are reading at the...
- 3
- 1.2K
- 5
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx
Ngày tải lên :
20/02/2014, 01:20
... significantly different basolateral ⁄ apical uptake ratio compared to the ratio obtained at h (data not shown) At 30 the basolateral ⁄ apical uptake ratio was 9.1 ± 3.7 and 5.2 ± 0.3 for 5-dayand ... dose and route of supplementation Data from a meta-analysis suggested that glutamine supplementation in critically ill patients may be associated with a decrease in complications and mortality rate, ... SCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQK EITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK Q EYDESGPSIVHR KCF B ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYP GQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPS SGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPR...
- 15
- 506
- 0
Báo cáo hóa học: " Vaccination with a plasmid DNA encoding HER-2/ neu together with low doses of GM-CSF and IL-2 in patients with metastatic breast carcinoma: a pilot clinical trial" pptx
Ngày tải lên :
18/06/2014, 16:20
... molecule Moreover, there is evidence that trastuzumab may synergize with specific T-cells [12], making a combinatorial approach with vaccination and trastuzumab an attractive clinical treatment modality ... by a relative A4 50 index of >2 or a titer
- 11
- 606
- 0
báo cáo hóa học: " Additional impact of concomitant hypertension and osteoarthritis on quality of life among patients with type 2 diabetes in primary care in Germany – a cross-sectional survey" doc
Ngày tải lên :
18/06/2014, 19:20
... 59,2% female) a random sample of 3546 patients (59,3% female) was drawn All participants were patients with type diabetes and insured by one large statutory regional health care fund called Allgemeine ... individual health status or well-being have gained more importance as patient-relevant outcome parameters within medical and health services research [7] Especially for patients suffering from one or ... JS and TR contributed substantially to the manuscript All authors read an approved the final manuscript Acknowledgements The authors are grateful to the AOK Sachsen-Anhalt and the AOK Rheinland-Pfalz...
- 7
- 458
- 0
Báo cáo sinh học: " Panicovirus accumulation is governed by two membrane-associated proteins with a newly identified conserved motif that contributes to pathogenicity" pptx
Ngày tải lên :
19/06/2014, 08:20
... CTCCAGACAGCCGCCTGGTTAGC CACACCCTGTAGAGGGCTCTCCAG CCTTTCTTATCAGCCACCCTGTAGAG GGAATACAGCTGGCAAGGC TGATCCTGGGCGTATGCGC GCCCCAACTAATGCATTGGTCACTAG CCAAGCAGTCGCATTGGCCCC a The altered nucleotides on the PMV cDNA are ... P31 7A- 989R N32 3A- 1007R L32 5A- 1014R REP/Y -A 1044R-C /A REP/F -A REP/D -A MUTPMV-1236R REP/W -A CCCCAGCGGCTTCGTTCTTTGC GGAACCCCAGCAAACTCGTTCTTTGC CTGTGGGTTTTGCAACCCCAGCG CAGCCAACTGGGCAGCCTCTGTG CTCCAGACAGCCGCCTGGTTAGC ... peroxidase (Amersham Pharmacia Biotech, Piscataway, NJ) was used at a 1:5,000 dilution and assayed by enzymatic reactions The remaining half of the extract was prepared for RNA blots, as described...
- 12
- 307
- 0
báo cáo hóa học: " Too much or too little step width variability is associated with a fall history in older persons who walk at or near normal gait speed" pdf
Ngày tải lên :
19/06/2014, 10:20
... ice that may affect balance.)" Participants, who reported a fall, were then asked to report the number of falls in the past year Data Analysis Prior to data analyses the gait variability data were ... others have shown an association with similar gait characteristics[13,17] One potential explanation may be the way the gait characteristics were measured in this study Gait variability was calculated ... Journal of NeuroEngineering and Rehabilitation 2005, 2:21 Background Variability of gait can be quantified using both temporal and spatial gait characteristics Variability of temporal characteristics...
- 8
- 402
- 0
báo cáo hóa học:" Percutaneous endoscopic lumbar discectomy: clinical and quality of life outcomes with a minimum 2 year follow-up" doc
Ngày tải lên :
20/06/2014, 01:20
... preoperative and month and years postoperative NASS and VAS scores There was significant improvement in the NASS scores for back disability and neurogenic symptoms and the VAS scores for back pain and ... Visual Analogue Scale pre and postoperatively Visual Analogue Scale pre and postoperatively tages of this technique include less paraspinal musculature trauma and smaller wounds Bone removal is ... Ditsworth DA: Endoscopic transforaminal lumbar discectomy and reconfiguration: A postero-lateral approach into the spinal canal Surg Neurol 1998, 49:588-98 Lew SM, Mehalic TF, Fagone KL: Transforaminal...
- 8
- 583
- 0
Báo cáo hóa học: " The product of the Herpes simplex virus 1 UL7 gene interacts with a mitochondrial protein, adenine nucleotide translocator 2" pot
Ngày tải lên :
20/06/2014, 01:20
... KS+ (Stratagene) 5'-AGGGCGGGGGCATCGGGCACCGGGATGGCCGCCGCGACGGCCGACGATG AGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCGACAGCAAGCGAACCGGAAT-3' GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCCGGAAATGTTGAATACTCA TACTCTTCCTTTTTC-3' ... (5'-cttgctggacgcagagcacta-3') and UL8-r (5'gatttcgcgcaggtgatgag-3') for UL8; and 18S rRNA-f (5'-actcaacacgggaaacctca-3') and 18S rRNA-r (5'-aaccagacaaatcgctccac-3') for 18S rRNA Reactions were performed using ... manufacturer's instructions Real-time PCR amplifications were performed with primers UL6-f (5'-aaattctgtgtcaccgcaacaac-3') and UL6-r (5'-gcccgaagcactgactcaa-3') for UL6; UL8-f (5'-cttgctggacgcagagcacta-3')...
- 13
- 463
- 0
Báo cáo hóa học: "Research Article A 2-bit Adaptive Delta Modulation System with Improved Performance" ppt
Ngày tải lên :
22/06/2014, 23:20
... LDM and ADM performance, Ph.D thesis, University of Thessaloniki, Thessaloniki, Greece, 1988 [8] G S Tombras and C A Karybakas, “New adaptation algorithm for a two- digit adaptive delta modulation ... International Conference on Acoustics, Speech and Signal Processing (ICASSP ’01), vol 4, pp 2621–2624, Salt Lake City, Utah, USA, May 2001 [10] M A Aldajani and A H Sayed, “Stability and performance ... system,” International Journal of Electronics, vol 68, no 3, pp 343–349, 1990 [9] M A Aldajani and A H Sayed, A stable adaptive structure for delta modulation with improved performance,” in Proceedings...
- 5
- 269
- 0
Chapter 052. Approach to the Patient with a Skin Disorder (Part 2) potx
Ngày tải lên :
06/07/2014, 20:20
... epidermal atrophy) Scar: A change in the skin secondary to trauma or inflammation Sites may be erythematous, hypopigmented, or hyperpigmented depending on their age or character Sites on hair-bearing ... epidermis without an associated loss of dermis Ulcer: Loss of epidermis and at least a portion of the underlying dermis Excoriation: Linear, angular erosions that may be covered by crust and are caused ... hair-bearing areas may be characterized by destruction of hair follicles Table 52-3 Common Dermatologic Terms Alopecia: Hair loss; it may be partial or complete Annular: Ring-shaped lesions Cyst: A soft,...
- 5
- 334
- 0